PDB entry 3fcx

View 3fcx on RCSB PDB site
Description: Crystal structure of human esterase D
Class: hydrolase
Keywords: retinoblastoma, genetic marker, esterase, HYDROLASE, Cytoplasm, Cytoplasmic vesicle, Polymorphism, Serine esterase
Deposited on 2008-11-24, released 2008-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-05-12, with a file datestamp of 2009-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.177
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: S-formylglutathione hydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ESD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10768 (0-281)
      • engineered (256)
    Domains in SCOPe 2.06: d3fcxa_
  • Chain 'B':
    Compound: S-formylglutathione hydrolase
    Species: Homo sapiens [TaxId:9606]
    Gene: ESD
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10768
      • engineered (256)
    Domains in SCOPe 2.06: d3fcxb_
  • Heterogens: MG, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fcxA (A:)
    malkqissnkcfgglqkvfehdsvelnckmkfavylppkaetgkcpalywlsgltcteqn
    fisksgyhqsasehglvviapdtsprgcnikgedeswdfgtgagfyvdatedpwktnyrm
    ysyvteelpqlinanfpvdpqrmsifghsmgghgalicalknpgkyksvsafapicnpvl
    cpwgkkafsgylgtdqskwkaydathlvksypgsqldilidqgkddqflldgqllpdnfi
    aactekkipvvfrlqedydhsyyfiatfitdhirhhakylna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcxA (A:)
    malkqissnkcfgglqkvfehdsvelnckmkfavylppkaetgkcpalywlsgltcteqn
    fisksgyhqsasehglvviapdtsprgcnifgtgagfyvdatedpwktnyrmysyvteel
    pqlinanfpvdpqrmsifghsmgghgalicalknpgkyksvsafapicnpvlcpwgkkaf
    sgylgskwkaydathlvksypldilidqgkddqflldgqllpdnfiaactekkipvvfrl
    qedydhsyyfiatfitdhirhhakylna
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fcxB (B:)
    malkqissnkcfgglqkvfehdsvelnckmkfavylppkaetgkcpalywlsgltcteqn
    fisksgyhqsasehglvviapdtsprgcnikgedeswdfgtgagfyvdatedpwktnyrm
    ysyvteelpqlinanfpvdpqrmsifghsmgghgalicalknpgkyksvsafapicnpvl
    cpwgkkafsgylgtdqskwkaydathlvksypgsqldilidqgkddqflldgqllpdnfi
    aactekkipvvfrlqedydhsyyfiatfitdhirhhakylna
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fcxB (B:)
    lkqissnkcfgglqkvfehdsvelnckmkfavylppkacpalywlsgltcteqnfisksg
    yhqsasehglvviapdtsprgcnikgedeswdfgtgagfyvdatedpwktnyrmysyvte
    elpqlinanfpvdpqrmsifghsmgghgalicalknpgkyksvsafapicnpvlcpwgkk
    afsgylgtdqskwkaydathlvksypgsqldilidqgkddqflldgqllpdnfiaactek
    kipvvfrlqedydhsyyfiatfitdhirhhakyln