PDB entry 3fct

View 3fct on RCSB PDB site
Description:
Deposited on 1999-06-13, released 1999-06-23
The last revision prior to the SCOP 1.69 freeze date was dated 1999-06-23, with a file datestamp of 1999-06-22.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.206
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d3fcta1, d3fcta2
  • Chain 'B':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d3fctb1, d3fctb2
  • Chain 'C':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d3fctc1, d3fctc2
  • Chain 'D':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.69: d3fctd1, d3fctd2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fctA (A:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fctB (B:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fctC (C:)
    elvmtqtpkfmsttvgdrvsitckasqnvgtpvawyqqkpgqspklliysasnrytgvpd
    rftgsgsgtdftltisnmqsedladyfcqqyssypltfgggtkveikrtvaapsvfifpp
    sdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqdskdstyslsstlt
    lskadyekhkvyacevthqglsspvtksfnrne
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fctD (D:)
    qvqllesgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigmidpnsggtky
    nekfkskatltvdkpsntaymqlssltsedsavyyctrrdmdywgagttvtvssastkgp
    svfplapsskstsggtaalgclvkdyfpepvtvswnsgaltsgvhtfpavlqssglysls
    svvtvpssslgtqtyicnvnhkpsntkvdkkivpks