PDB entry 3fcr

View 3fcr on RCSB PDB site
Description: Crystal structure of putative aminotransferase (YP_614685.1) from SILICIBACTER SP. TM1040 at 1.80 A resolution
Class: transferase
Keywords: YP_614685.1, putative aminotransferase, Structural Genomics, Joint Center for Structural Genomics, JCSG, Protein Structure Initiative, PSI-2, Aminotransferase, Pyridoxal phosphate, Transferase
Deposited on 2008-11-22, released 2009-01-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative aminotransferase
    Species: Silicibacter sp. TM1040 [TaxId:292414]
    Gene: TM1040_2691, YP_614685.1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q1GD43 (1-457)
      • leader sequence (0)
      • microheterogeneity (288)
    Domains in SCOPe 2.07: d3fcra1, d3fcra2
  • Heterogens: PLP, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fcrA (A:)
    gmlkndqldqwdrdnffhpsthlaqhargesanrviktasgvfiedrdgtklldafagly
    cvnvgygrqeiaeaiadqarelayyhsyvghgteasitlakmildrapknmskvyfglgg
    sdanetnvkliwyynnilgrpekkkiisrwrgyhgsglvtgsltglelfhkkfdlpveqv
    ihteapyyfrredlnqteeqfvahcvaelealieregadtiaafigepilgtggivpppa
    gyweaiqtvlnkhdillvadevvtgfgrlgtmfgsdhyglepdiitiakgltsayaplsg
    sivsdkvwkvleqgtdengpighgwtysahpigaaagvanlklldelnlvsnagevgayl
    natmaealsqhanvgdvrgegllcavefvkdrdsrtffdaadkigpqisaklleqdkiia
    rampqgdilgfappfcltraeadqvvegtlravkavlg