PDB entry 3fcn

View 3fcn on RCSB PDB site
Description: crystal structure of an alpha-helical protein of unknown function (rru_a3208) from rhodospirillum rubrum atcc 11170 at 1.45 a resolution
Deposited on 2008-11-21, released 2008-12-09
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: N/A
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: an alpha-helical protein of unknown function (Pfam01724)
    Species: Rhodospirillum rubrum ATCC 11170 [TaxId:269796]
    Gene: Rru_A3208, YP_428290.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3fcnA (A:)
gmgmehktyeadlfvwcqqqadglralsrsrrdlpddldlehiaeeiedmgrselreats
lvrqicvrvimamsapeapdrarwrsevvswhnllldtitpgmidridigviwrravsea
kaalieinvapqaglsfqaplpadhfldedfdydatvarlgpta

    Sequence, based on observed residues (ATOM records):
    >3fcnA (A:)
ehktyeadlfvwcqqqadglralsrsrrdlpddldlehiaeeiedmgrselreatslvrq
icvrvimamsapeapdrarwrsevvswhnllldtitpgmidridigviwrravseakaal
ieinvapqaglsfqaplpadhfldedfdydatvarlgp