PDB entry 3fck

View 3fck on RCSB PDB site
Description: Complex of UNG2 and a fragment-based design inhibitor
Class: hydrolase
Keywords: DNA REPAIR, URACIL, URACIL DNA GLYCOSYLASE, Alternative splicing, Disease mutation, DNA damage, Glycosidase, Host-virus interaction, Hydrolase, Mitochondrion, Nucleus, Phosphoprotein, Transit peptide
Deposited on 2008-11-21, released 2009-04-28
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-06-02, with a file datestamp of 2009-05-29.
Experiment type: XRAY
Resolution: 1.64 Å
R-factor: 0.197
AEROSPACI score: 0.56 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'B':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG, DGU, UNG1, UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • expression tag (1-2)
    Domains in SCOPe 2.04: d3fckb_
  • Heterogens: FCK, HOH

PDB Chain Sequences:

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fckB (B:)
    meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
    lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
    llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
    hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fckB (B:)
    effgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvil
    gqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvll
    lnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrhh
    vlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel