PDB entry 3fcf

View 3fcf on RCSB PDB site
Description: complex of ung2 and a fragment-based designed inhibitor
Deposited on 2008-11-21, released 2009-04-28
The last revision was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.84 Å
R-factor: N/A
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uracil-DNA glycosylase
    Species: Homo sapiens [TaxId:9606]
    Gene: UNG, DGU, UNG1, UNG15
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13051 (3-222)
      • expression tag (0-2)
  • Heterogens: FCF, SCN, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fcfA (A:)
meffgeswkkhlsgefgkpyfiklmgfvaeerkhytvyppphqvftwtqmcdikdvkvvi
lgqdpyhgpnqahglcfsvqrpvppppsleniykelstdiedfvhpghgdlsgwakqgvl
llnavltvrahqanshkergweqftdavvswlnqnsnglvfllwgsyaqkkgsaidrkrh
hvlqtahpsplsvyrgffgcrhfsktnellqksgkkpidwkel