PDB entry 3fc8

View 3fc8 on RCSB PDB site
Description: Crystal structure of transthyretin in complex with iododiflunisal-betaAlaOMe
Class: hormone binding protein
Keywords: transthyretin, amyloid, inhibitors, iodine, Polymorphism, Polyneuropathy, Retinol-binding, Secreted, HORMONE BINDING PROTEIN
Deposited on 2008-11-21, released 2009-02-17
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-17, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.196
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fc8a_
  • Chain 'B':
    Compound: Transthyretin
    Species: Homo sapiens [TaxId:9606]
    Gene: TTR, PALB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3fc8b_
  • Heterogens: IFA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fc8A (A:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc8A (A:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3fc8B (B:)
    gptgtgeskcplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltt
    eeefvegiykveidtksywkalgispfhehaevvftandsgprrytiaallspysystta
    vvtn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc8B (B:)
    cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
    kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn