PDB entry 3fc4

View 3fc4 on RCSB PDB site
Description: Ethylene glycol inhibited form of Aldehyde oxidoreductase from Desulfovibrio gigas
Class: oxidoreductase
Keywords: Mo-ethylene glycol adduct, 2Fe-2S, FAD, Flavoprotein, Iron, Iron-sulfur, Metal-binding, Molybdenum, NAD, Oxidoreductase
Deposited on 2008-11-21, released 2009-10-06
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 1.79 Å
R-factor: 0.155
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: aldehyde oxidoreductase
    Species: Desulfovibrio gigas [TaxId:879]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3fc4a1, d3fc4a2, d3fc4a3, d3fc4a4
  • Heterogens: MG, CL, FES, PCD, EDO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fc4A (A:)
    miqkvitvngieqnlfvdaeallsdvlrqqlgltgvkvgceqgqcgacsvildgkvvrac
    vtkmkrvadgaqittiegvgqpenlhplqkawvlhggaqcgfcspgfivsakglldtnad
    psredvrdwfqkhrnacrctgykplvdavmdaaavingkkpetdlefkmpadgriwgsky
    prptavakvtgtldygadlglkmpagtlhlamvqakvshanikgidtsealtmpgvhsvi
    thkdvkgknritglitfptnkgdgwdrpilcdekvfqygdcialvcadseanaraaaekv
    kvdleelpaymsgpaaaaedaieihpgtpnvyfeqpivkgedtgpifasadvtvegdfyv
    grqphmpiepdvafaymgddgkcyihsksigvhlhlymiapgvglepdqlvlvanpmggt
    fgykfsptsealvavaamatgrpvhlrynyqqqqqytgkrspwemnvkfaakkdgtllam
    esdwlvdhgpysefgdlltlrgaqfigagynipnirglgrtvatnhvwgsafrgygapqs
    mfaseclmdmlaeklgmdplelryknayrpgdtnptgqepevfslpdmidqlrpkyqaal
    ekaqkestathkkgvgisigvygsgldgpdaseawaelnadgtitvhtawedhgqgadig
    cvgtahealrpmgvapekikftwpntattpnsgpsggsrqqvmtgnairvacenllkace
    kpgggyytydelkaadkptkitgnwtasgathcdavtglgkpfvvymygvfmaevtvdva
    tgqttvdgmtlmadlgslcnqlatdgqiygglaqgiglalsedfedikkhatlvgagfpf
    ikqipdkldivyvnhprpdgpfgasgvgelpltsphaaiinaiksatgvriyrlpaypek
    vlealka