PDB entry 3fc1

View 3fc1 on RCSB PDB site
Description: Crystal structure of p38 kinase bound to pyrimido-pyridazinone inhibitor
Class: transferase
Keywords: kinase inhibitor, ATP-binding, Nucleotide-binding, Nucleus, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-11-20, released 2008-12-09
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.204
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: Mitogen-activated protein kinase 14
    Species: Homo sapiens [TaxId:9606]
    Gene: MAPK14, CSBP, CSBP1, CSBP2, CSPB1, MXI2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3fc1x_
  • Heterogens: CL, 52P, HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3fc1X (X:)
    gshmlemsqerptfyrqelnktiwevperyqnlspvgsgaygsvcaafdtktglrvavkk
    lsrpfqsiihakrtyrelrllkhmkhenviglldvftparsleefndvylvthlmgadln
    nivkcqkltddhvqfliyqilrglkyihsadiihrdlkpsnlavnedcelkildfglarh
    tddemtgyvatrwyrapeimlnwmhynqtvdiwsvgcimaelltgrtlfpgtdhidqlkl
    ilrlvgtpgaellkkissesarnyiqsltqmpkmnfanvfiganplavdllekmlvldsd
    kritaaqalahayfaqyhdpddepvadpydqsfesrdllidewksltydevisfvpppld
    qeemes
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fc1X (X:)
    rptfyrqelniwevperyqnlspvgsvcaafdtktglrvavkklsrpfqsiihakrtyre
    lrllkhmkhenviglldvftparsleefndvylvthlmgadlnnivkcqkltddhvqfli
    yqilrglkyihsadiihrdlkpsnlavnedcelkildfgmtgyvatrwyrapeimlnwmh
    ynqtvdiwsvgcimaelltgrtlfpgtdhidqlklilrlvgtpgaellkkissesarnyi
    qsltqmpkmnfanvfiganplavdllekmlvldsdkritaaqalahayfaqyhdpddepv
    adpydqsfesrdllidewksltydevisfvpppl