PDB entry 3fbm

View 3fbm on RCSB PDB site
Description: D431N Mutant VP2 Protein of Infectious Bursal Disease Virus; Derived T=1 Particles
Class: Virus
Keywords: capsid protein, autoproteolytic activity, capsid maturation, virus assembly, IBDV, Virus
Deposited on 2008-11-19, released 2009-01-13
The last revision prior to the SCOPe 2.08 freeze date was dated 2012-05-30, with a file datestamp of 2012-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.294
AEROSPACI score: 0.16 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Polyprotein
    Species: Avian Infectious bursal disease virus [TaxId:10995]
    Gene: CAPSID PROTEIN VP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9WI42
      • engineered (430)
    Domains in SCOPe 2.08: d3fbma_
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3fbmA (A:)
    mtnlsdqtqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivff
    pgfpgsivgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlpggvyal
    ngtinavtfqgslseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrl
    gdpipaigldpkmvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitsl
    svggelvfrtsvhglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptne
    itqpitsikleivtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatg
    svvtvagvsnfelipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreyt
    dfreyfmevanlnsplkiagafgfkdiirair
    

    Sequence, based on observed residues (ATOM records): (download)
    >3fbmA (A:)
    tqqivpfirsllmpttgpasipddtlekhtlrsetstynltvgdtgsglivffpgfpgsi
    vgahytlqgngnykfdqmlltaqnlpasynycrlvsrsltvrsstlplngtinavtfqgs
    lseltdvsynglmsatanindkignvlvgegvtvlslptsydlgyvrlgdpipaigldpk
    mvatcdssdrprvytitaaddyqfssqyqpggvtitlfsanidaitslsvggelvfrtsv
    hglvlgatiyligfdgttvitravaannglttgtdnlmpfnlviptneitqpitsiklei
    vtsksggqagdqmswsargslavtihggnypgalrpvtlvayervatgsvvtvagvsnfe
    lipnpelaknlvteygrfdpgamnytklilserdrlgiktvwptreytdfreyfmevanl
    nsplkiag