PDB entry 3fbl

View 3fbl on RCSB PDB site
Description: Crystal structure of ORF132 of the archaeal virus Acidianus Filamentous Virus 1 (AFV1)
Deposited on 2008-11-19, released 2009-11-10
The last revision was dated 2009-12-22, with a file datestamp of 2009-12-18.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.162
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative uncharacterized protein
    Species: ACIDIANUS FILAMENTOUS VIRUS 1 [TaxId:235266]
    Gene: AFV1_ORF132
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3fblA (A:)
yhklrlaikeicktdgipnikwgmyiafgekllksylkmkagsassdmiaeyinnaisaf
ssrtgisqetaqkiadfitsny