PDB entry 3fba

View 3fba on RCSB PDB site
Description: Crystal structure of 2C-methyl-D-erythritol 2,4-clycodiphosphate synthase complexed with ligand
Class: lyase
Keywords: MECDP-synthase, lyase, Isoprene biosynthesis, Magnesium, Manganese, Metal-binding
Deposited on 2008-11-19, released 2009-08-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 3.1 Å
R-factor: 0.187
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Escherichia coli [TaxId:83333]
    Gene: ISPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P62617 (6-End)
      • expression tag (4-5)
    Domains in SCOPe 2.08: d3fbaa1, d3fbaa2
  • Heterogens: ZN, C6B, GPP, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3fbaA (A:)
gshmlemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaal
gdigklfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrv
fiaedlgchmddvnvkattteklgftgrgegiaceavallikatk

    Sequence, based on observed residues (ATOM records): (download) 
    >3fbaA (A:)
lemrighgfdvhafggegpiiiggvripyekgllahsdgdvalhaltdallgaaalgdig
klfpdtdpafkgadsrellreawrriqakgytlgnvdvtiiaqapkmlphipqmrvfiae
dlgchmddvnvkattteklgftgrgegiaceavallik