PDB entry 3fad

View 3fad on RCSB PDB site
Description: Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His
Class: hydrolase
Keywords: Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase, T4 lysozyme, bond angle strain, rotamer strain, temperature sensitive mutant
Deposited on 2008-11-17, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.2 Å
R-factor: N/A
AEROSPACI score: 0.65 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Enterobacteria phage T4 [TaxId:10665]
    Gene: GENE E
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00720 (0-163)
      • engineered (71)
      • engineered (95)
    Domains in SCOPe 2.08: d3fada_
  • Heterogens: PO4, BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3fadA (A:)
mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
deaeklfnqdvaaavrgilrnaklkpvydsldavrhcalinmvfqmgetgvagftnslrm
lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl