PDB entry 3fa9

View 3fa9 on RCSB PDB site
Description: Crystal structure of the apo R132K:Y134F:R111L:L121D mutant of cellular retinoic acid-binding protein II at 1.94 angstrom resolution
Class: transport protein
Keywords: CRABPII, retinoic acid, retinoid, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-11-16, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-26, with a file datestamp of 2014-11-21.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (110)
      • engineered (120)
      • engineered (131)
      • engineered (133)
    Domains in SCOPe 2.07: d3fa9a_
  • Chain 'B':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (110)
      • engineered (120)
      • engineered (131)
      • engineered (133)
    Domains in SCOPe 2.07: d3fa9b_
  • Heterogens: ACT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fa9A (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    dtmtaddvvctkvfvre
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3fa9B (B:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvrt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    dtmtaddvvctkvfvre