PDB entry 3f9r

View 3f9r on RCSB PDB site
Description: Crystal Structure of Trypanosoma Brucei phosphomannosemutase, TB.10.700.370
Class: isomerase
Keywords: trypanosome glycobiology structural genomics, Isomerase, Structural Genomics Consortium, SGC
Deposited on 2008-11-14, released 2009-03-10
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-03-10, with a file datestamp of 2009-03-06.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.202
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phosphomannomutase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.70.0370, TB10.700.370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38AW2 (1-245)
      • expression tag (0)
    Domains in SCOPe 2.01: d3f9ra_
  • Chain 'B':
    Compound: Phosphomannomutase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb10.70.0370, TB10.700.370
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q38AW2 (1-245)
      • expression tag (0)
    Domains in SCOPe 2.01: d3f9rb_
  • Heterogens: SO4, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f9rA (A:)
    gmkrvlllfdvdgtltpprlcqtdemralikrargagfcvgtvggsdfakqveqlgrdvl
    tqfdyvfaengllayrngleihrqsllnalgndrivkfvkktlrliadldipvqrgtfve
    yrngminvspigrncsqaerdefevydnehrvrasliaelensfpdfglkysiggqisfd
    vfpvgwdktyclqfveddfeeihffgdktqeggndyeiytdkrtighkvtsykdtiaeve
    kiiamk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f9rB (B:)
    gmkrvlllfdvdgtltpprlcqtdemralikrargagfcvgtvggsdfakqveqlgrdvl
    tqfdyvfaengllayrngleihrqsllnalgndrivkfvkktlrliadldipvqrgtfve
    yrngminvspigrncsqaerdefevydnehrvrasliaelensfpdfglkysiggqisfd
    vfpvgwdktyclqfveddfeeihffgdktqeggndyeiytdkrtighkvtsykdtiaeve
    kiiamk