PDB entry 3f9n

View 3f9n on RCSB PDB site
Description: Crystal structure of chk1 kinase in complex with inhibitor 38
Class: transferase
Keywords: chek1, chk1, kinase, cell cycle checkpoint, ATP-binding, Cytoplasm, DNA damage, DNA repair, Nucleotide-binding, Nucleus, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase, Ubl conjugation
Deposited on 2008-11-14, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-04-28, with a file datestamp of 2009-04-24.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.184
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Serine/threonine-protein kinase Chk1
    Species: Homo sapiens [TaxId:9606]
    Gene: CHEK1, CHK1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f9na_
  • Heterogens: 38M, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f9nA (A:)
    avpfvedwdlvqtlgegaygevqlavnrvteeavavkivdmkravdcpenikkeicinkm
    lnhenvvkfyghrregniqylfleycsggelfdriepdigmpepdaqrffhqlmagvvyl
    hgigithrdikpenlllderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkr
    refhaepvdvwscgivltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplal
    lhkilvenpsaritipdikkdrwynkplkkgakrprvtsggvsespsgfskhiqsnldfs
    pvnsasrtpgsgwskehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f9nA (A:)
    edwdlvqtlggevqlavnrvteeavavkivdmknikkeicinkmlnhenvvkfyghrreg
    niqylfleycsggelfdriepdigmpepdaqrffhqlmagvvylhgigithrdikpenll
    lderdnlkisdfglatvfrynnrerllnkmcgtlpyvapellkrrefhaepvdvwscgiv
    ltamlagelpwdqpsdscqeysdwkekktylnpwkkidsaplallhkilvenpsaritip
    dikkdrwynkplk