PDB entry 3f9b

View 3f9b on RCSB PDB site
Description: W354F Yersinia enterocolitica PTPase complexed with divanadate
Class: hydrolase
Keywords: Hydrolase, P-loop, WPD-loop, PTP, Protein Phosphatase, vanadate, divanadate, Membrane, Outer membrane, Secreted, Virulence
Deposited on 2008-11-13, released 2009-01-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 1.42 Å
R-factor: N/A
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Tyrosine-protein phosphatase yopH
    Species: Yersinia enterocolitica (type O:9) [TaxId:34055]
    Gene: yopH, yop51
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15273 (Start-305)
      • engineered (72)
      • engineered (191)
    Domains in SCOPe 2.07: d3f9ba_
  • Heterogens: VO4, PDV, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f9bA (A:)
    mrerphtsghhgagearatapstvspygpearaelssrlttlrntlapatndprylqacg
    geklnrfrdiqcrrqtavradlnanyiqvgntrtiacqyplqsqleshfrmlaenrtpvl
    avlassseianqrfgmpdyfrqsgtygsitveskmtqqvglgdgimadmytltireagqk
    tisvpvvhvgnfpdqtavssevtkalaslvdqtaetkrnmyeskgssavaddsklrpvih
    cragvgrtaqligamcmndsrnsqlsvedmvsqmrvqrngimvqkdeqldvliklaegqg
    rpllns
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f9bA (A:)
    spygpearaelssrlttlrntlapatndprylqacggeklnrfrdiqcrrqtavradlna
    nyiqvgntrtiacqyplqsqleshfrmlaenrtpvlavlassseianqrfgmpdyfrqsg
    tygsitveskmtqqvglgdgimadmytltireagqktisvpvvhvgnfpdqtavssevtk
    alaslvdqtaetkrnmyeskgssavaddsklrpvihcragvgrtaqligamcmndsrnsq
    lsvedmvsqmrvqrngimvqkdeqldvliklaegqgrpllns