PDB entry 3f92

View 3f92 on RCSB PDB site
Description: Crystal structure of ubiquitin-conjugating enzyme E2-25kDa (Huntington Interacting Protein 2) M172A mutant crystallized at pH 8.5
Class: ligase
Keywords: Ubiquitin-Conjugating, Huntington Interacting, E2-25K, Ligase, Ubiquitin-conjugating enzyme E2 K, E2(25K), Ubiquitin-protein ligase, Ubiquitin carrier protein, Huntington-interacting protein 2, HIP-2, Alternative splicing, Cytoplasm, Ubl conjugation, Ubl conjugation pathway
Deposited on 2008-11-13, released 2008-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-06-28, with a file datestamp of 2017-06-23.
Experiment type: XRAY
Resolution: 2.23 Å
R-factor: N/A
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 K
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2K, HIP2, LIG
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61086 (53-252)
      • expression tag (51-52)
      • engineered mutation (224)
    Domains in SCOPe 2.08: d3f92a1, d3f92a2, d3f92a3
  • Heterogens: PG4, BME, TRS, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f92A (A:)
    mhhhhhhssglvprgsgmketaaakferqhmdspdlgtddddkamadigsefdmaniavq
    rikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryqleikipetyp
    fnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqallaaaepddpqd
    avvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcaagfdrnavivalssks
    wdvetatelllsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f92A (A:)
    fdmaniavqrikrefkevlkseetsknqikvdlvdenftelrgeiagppdtpyeggryql
    eikipetypfnppkvrfitkiwhpnissvtgaicldilkdqwaaamtlrtvllslqalla
    aaepddpqdavvanqykqnpemfkqtarlwahvyagapvsspeytkkienlcaagfdrna
    vivalsskswdvetatelllsn