PDB entry 3f8v

View 3f8v on RCSB PDB site
Description: Evaulaution at Atomic Resolution of the Role of Strain in Destabilizing the Temperature Sensitive T4 Lysozyme Mutant Arg96-->His
Class: hydrolase
Keywords: Antimicrobial, Bacteriolytic enzyme, Glycosidase, Hydrolase, T4 lysozyme, bond angle strain, rotamer strain, temperature sensitive mutant
Deposited on 2008-11-13, released 2009-02-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2018-01-24, with a file datestamp of 2018-01-19.
Experiment type: XRAY
Resolution: 1.08 Å
R-factor: N/A
AEROSPACI score: 0.75 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: lysozyme
  Species: Enterobacteria phage T4 [TaxId:10665]
  Gene: GENE E
  Database cross-references and differences (RAF-indexed):
  • Uniprot P00720 (0-163)
    • engineered (95)
  Domains in SCOPe 2.08: d3f8va_
• Heterogens: HED, PO4, CL, NA, K, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >3f8vA (A:)
  mnifemlrideglrlkiykdtegyytigighlltkspslnaakseldkaigrncngvitk
  deaeklfnqdvdaavrgilrnaklkpvydsldavrhcalinmvfqmgetgvagftnslrm
  lqqkrwdeaavnlaksrwynqtpnrakrvittfrtgtwdayknl