PDB entry 3f8a

View 3f8a on RCSB PDB site
Description: Crystal Structure of the R132K:R111L:L121E:R59W Mutant of Cellular Retinoic Acid-Binding Protein Type II Complexed with C15-aldehyde (a retinal analog) at 1.95 Angstrom resolution.
Class: transport protein
Keywords: CRABPII, retinal, protonated schiff base, C15-aldehyde, retinoic acid, retinoid, Nucleus, Retinol-binding, Transport, Vitamin A, TRANSPORT PROTEIN
Deposited on 2008-11-12, released 2009-11-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2016-12-28, with a file datestamp of 2016-12-22.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellular retinoic acid-binding protein 2
    Species: Homo sapiens [TaxId:9606]
    Gene: CRABP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P29373 (0-136)
      • engineered (58)
      • engineered (110)
      • engineered (120)
      • engineered (131)
    Domains in SCOPe 2.08: d3f8aa_
  • Heterogens: B3P, LSR, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f8aA (A:)
    pnfsgnwkiirsenfeellkvlgvnvmlrkiavaaaskpaveikqegdtfyiktsttvwt
    teinfkvgeefeeqtvdgrpckslvkwesenkmvceqkllkgegpktswtleltndgeli
    etmtaddvvctkvyvre