PDB entry 3f82

View 3f82 on RCSB PDB site
Description: Crystal structure of the tyrosine kinase domain of the hepatocyte growth factor receptor C-MET in complex with N-(4-(2-amino-3-chloropyridin-4-yloxy)-3-fluorophenyl)-4-ethoxy-1-(4-fluorophenyl)-2-oxo-1,2-dihydropyridine-3-carboxamide
Class: transferase
Keywords: Alternative splicing, RECEPTOR TYROSINE KINASE, SIGNAL TRANSDUCTION, GRB2, SHC, ATP-BINDING, GLYCOPROTEIN, MEMBRANE, NUCLEOTIDE-BINDING, PHOSPHOPROTEIN, PROTO-ONCOGENE, TRANSFERASE, TRANSMEMBRANE, TYROSINE-PROTEIN KINASE
Deposited on 2008-11-11, released 2009-03-31
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-03-31, with a file datestamp of 2009-03-27.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.183
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hepatocyte growth factor receptor
    Species: Homo sapiens [TaxId:9606]
    Gene: MET
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08581 (Start-313)
      • engineered (147)
    Domains in SCOPe 2.06: d3f82a_
  • Heterogens: 353, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f82A (A:)
    gantvhidlsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtlldndgkkih
    cavkslnritdigevsqfltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlr
    nfirnethnptvkdligfglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgla
    rdmydkefdsvhnktgaklpvkwmaleslqtqkfttksdvwsfgvllwelmtrgappypd
    vntfditvyllqgrrllqpeycpdplyevmlkcwhpkaemrpsfselvsrisaifstfig
    ehyvhvnatyvnvk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f82A (A:)
    lsalnpelvqavqhvvigpsslivhfnevigrghfgcvyhgtllkihcavkslnrgevsq
    fltegiimkdfshpnvlsllgiclrsegsplvvlpymkhgdlrnfirnethnptvkdlig
    fglqvakgmkflaskkfvhrdlaarncmldekftvkvadfgklpvkwmaleslqtqkftt
    ksdvwsfgvllwelmtrgappypdvntfditvyllqgrrllqpeycpdplyevmlkcwhp
    kaemrpsfselvsrisaifstfigehyvhvnatyvnvk