PDB entry 3f7s

View 3f7s on RCSB PDB site
Description: crystal structure of a ntf2-like protein of unknown function (pp_4556) from pseudomonas putida kt2440 at 2.11 a resolution
Deposited on 2008-11-10, released 2008-11-25
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: N/A
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized NTF2-like protein
    Species: Pseudomonas putida KT2440 [TaxId:160488]
    Gene: NP_746665.1, PP4556, PP_4556
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q88EB0 (1-141)
      • leader sequence (0)
  • Heterogens: UNL, SO4, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >3f7sA (A:)
gmstaaeseirqlierwmqavrdrdipgiiapyaddivafdaiqalqfkgksaytahwem
cmgmctgpmvfelaqltvhaagdlalahwlnrcgpgddesqcgfmratvgyrrqggqwqv
ihehwsapfdmetqkalfdlkp