PDB entry 3f7n
View 3f7n on RCSB PDB site
Description: Crystal Structure of CheY triple mutant F14E, N59M, E89L complexed with BeF3- and Mn2+
Class: signaling protein
Keywords: Response Regulator, Receiver Domain, BeF3, Two-Component Signal Transduction, Chemotaxis, Flagellar rotation, Magnesium, Metal-binding, Phosphoprotein, Two-component regulatory system, SIGNALING PROTEIN
Deposited on
2008-11-09, released
2009-09-22
The last revision prior to the SCOPe 2.08 freeze date was dated
2017-10-25, with a file datestamp of
2017-10-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.32
(click here for full SPACI score report)
Chains and heterogens:
- Chain 'A':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:83333]
Gene: b1882, cheY, JW1871
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (0-127)
- engineered (12)
- engineered (57)
- engineered (87)
Domains in SCOPe 2.08: d3f7na_ - Chain 'B':
Compound: Chemotaxis protein cheY
Species: Escherichia coli [TaxId:83333]
Gene: b1882, cheY, JW1871
Database cross-references and differences (RAF-indexed):
- Uniprot P0AE67 (0-127)
- engineered (12)
- engineered (57)
- engineered (87)
Domains in SCOPe 2.08: d3f7nb_ - Heterogens: MN, BEF, GOL, SO4, HOH
PDB Chain Sequences:
- Chain 'A':
Sequence; same for both SEQRES and ATOM records: (download)
>3f7nA (A:)
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtalakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm
- Chain 'B':
Sequence; same for both SEQRES and ATOM records: (download)
>3f7nB (B:)
adkelkflvvddestmrrivrnllkelgfnnveeaedgvdalnklqaggygfvisdwmmp
nmdglellktiradgamsalpvlmvtalakkeniiaaaqagasgyvvkpftaatleekln
kifeklgm