PDB entry 3f7m

View 3f7m on RCSB PDB site
Description: Crystal structure of apo Cuticle-Degrading Protease (ver112) from Verticillium psalliotae
Class: hydrolase
Keywords: Verticillium psalliotae, Cuticle-Degrading Protease, Nematodes, Hydrolase, Protease, Secreted, Serine protease, Zymogen
Deposited on 2008-11-09, released 2009-11-17
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-04-02, with a file datestamp of 2014-03-28.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.217
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline serine protease ver112
    Species: Lecanicillium psalliotae [TaxId:73499]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q68GV9 (0-278)
      • conflict (108)
    Domains in SCOPe 2.08: d3f7ma_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >3f7mA (A:)
itqqqgatwgltrishrargstayaydtsagagacvyvidtgvedthpdfegrakqiksy
astardghghgthcagtigsktwgvakkvsifgvkvlddsgsgslsniiagmdfvasdrq
srncprrtvasmslgggysaalnqaaarlqssgvfvavaagndnrdaantspaseptvct
vgatdsndvrstfsnygrvvdifapgtsitstwiggrtntisgtsmatphiaglaaylfg
leggsagamcgriqtlstknvltsipsgtvnylafngat