PDB entry 3f7l

View 3f7l on RCSB PDB site
Description: X-ray Crystal Structure of Alvinella pompejana Cu,Zn Superoxide Dismutase
Class: oxidoreductase
Keywords: OXIDOREDUCTASE (SUPEROXIDE ACCEPTOR), superoxide dismutase, Greek key beta-barrel, amyloid filaments, ALS, FALS, Lou Gehrig's disease, amyotrophic lateral sclerosis, Alvinella pompejana, Pompeii worm, eukaryotic thermophile, thermostable protein
Deposited on 2008-11-09, released 2009-02-10
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-10, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 0.99 Å
R-factor: 0.13
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Copper,Zinc Superoxide Dismutase
  Species: Alvinella pompejana [TaxId:6376]
  Database cross-references and differences (RAF-indexed):
  • PDB 3F7L (0-End)
  Domains in SCOPe 2.08: d3f7la_
• Heterogens: CU1, CU, ZN, NA, ACY, SO4, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >3f7lA (A:)
  aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg
  hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd
  eddlgrggheqskitgnaggrlacgvigitke
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >3f7lA (A:)
  aihavcvlkgdspvtgtihlkeegdmvtvtgeitgltpgkhgfhvhefgdntngctsagg
  hfnphgkehgapedenrhagdlgnvvagedgkavinmkdklvkltgpdsvigrtlvvhvd
  eddlgrggheqskitgnaggrlacgvigitk