PDB entry 3f6q

View 3f6q on RCSB PDB site
Description: Crystal structure of integrin-linked kinase ankyrin repeat domain in complex with PINCH1 LIM1 domain
Class: signaling protein/signaling protein
Keywords: ILK, Integrin-linked kinase, PINCH, LIM, Ankyrin repeat, ANK, IPP, Integrin-mediated signaling, ANK repeat, ATP-binding, Cell junction, Cell membrane, Kinase, Membrane, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Acetylation, LIM domain, Metal-binding, Zinc, TRANSFERASE/METAL BINDING PROTEIN COMPLEX, SIGNALING PROTEIN/SIGNALING PROTEIN COMPLEX
Deposited on 2008-11-06, released 2008-12-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-01-27, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.163
AEROSPACI score: 0.62 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Integrin-linked protein kinase
    Species: Homo sapiens [TaxId:9606]
    Gene: ILK, ILK1, ILK2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3f6qa_
  • Chain 'B':
    Compound: LIM and senescent cell antigen-like-containing domain protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: LIMS1, PINCH, PINCH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P48059 (9-71)
      • expression tag (0-8)
  • Heterogens: IOD, PO4, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f6qA (A:)
    gspefmddiftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlim
    rgarinvmnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqv
    aedlvangalvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwkgttr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f6qA (A:)
    ddiftqcregnavavrlwldntendlnqgddhgfsplhwacregrsavvemlimrgarin
    vmnrgddtplhlaashghrdivqkllqykadinavnehgnvplhyacfwgqdqvaedlva
    ngalvsicnkygempvdkakaplrellreraekmgqnlnripykdtfwk
    

  • Chain 'B':
    No sequence available.