PDB entry 3f6p

View 3f6p on RCSB PDB site
Description: Crystal Structure of unphosphorelated receiver domain of YycF
Class: transcription regulator
Keywords: unphosphorelated, receiver domain, Cytoplasm, DNA-binding, Phosphoprotein, Transcription, Transcription regulation, Two-component regulatory system, DNA BINDING PROTEIN, TRANSCRIPTION REGULATOR
Deposited on 2008-11-06, released 2010-03-02
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional regulatory protein yycF
    Species: Bacillus subtilis [TaxId:224308]
    Gene: BSU40410, yycF
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3f6pa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f6pA (A:)
    mdkkilvvddekpiadilefnlrkegyevhcahdgneavemveelqpdlilldimlpnkd
    gvevcrevrkkydmpiimltakdseidkvigleigaddyvtkpfstrellarvkanlrrq