PDB entry 3f6m

View 3f6m on RCSB PDB site
Description: Crystal Structure of 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase IspF from Yersinia pestis
Class: lyase
Keywords: alpha-beta structure, structural genomics of infectious diseases, Isoprene biosynthesis, Lyase, Metal-binding, Center for Structural Genomics of Infectious Diseases, CSGID
Deposited on 2008-11-06, released 2008-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-05-05, with a file datestamp of 2009-05-01.
Experiment type: XRAY
Resolution: 2.96 Å
R-factor: 0.195
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase
    Species: Yersinia pestis [TaxId:214092]
    Gene: ispF, y0829, YPO3360, YP_0327
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8ZBP7 (3-End)
      • expression tag (1-2)
    Domains in SCOPe 2.08: d3f6ma1, d3f6ma2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3f6mA (A:)
snamrighgfdvhkfgengsgpliiggvripyekgllahsdgdvalhaatdallgaaalg
digklfpdtdpafkgadsrgllreayrrilakgyklgnlditiiaqapkmaphipqmrvn
laedlqchmddinvkattteqlgftgrgegiaceavvllvnveqg

    Sequence, based on observed residues (ATOM records): (download) 
    >3f6mA (A:)
namrighgfdvhkfgengsgpliiggvripyekgllahsdgdvalhaatdallgaaalgd
igklfpdtdpafkgadsrgllreayrrilakgyklgnlditiiaqapkmaphipqmrvnl
aedlqchmddinvkattteqlgftgrgegiaceavvllvnv