PDB entry 3f63

View 3f63 on RCSB PDB site
Description: Crystal structure of a Delta class GST (adGSTD4-4) from Anopheles dirus, in complex with S-hexyl glutathione
Class: transferase
Keywords: glutathione transferase, transferase
Deposited on 2008-11-05, released 2009-10-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.181
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione transferase GST1-4
    Species: Anopheles dirus [TaxId:7168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f63a1, d3f63a2
  • Chain 'B':
    Compound: glutathione transferase GST1-4
    Species: Anopheles dirus [TaxId:7168]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3f63b1, d3f63b2
  • Heterogens: GTX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f63A (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f63A (A:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f63B (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryftqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f63B (B:)
    mdfyylpgsapcravqmtaaavgvelnlkltnlmagehmkpeflklnpqhciptlvdedg
    fvlwesraiqiylvekygahdadlaerlypsdprrravvhqrlffdvavlyqrfaeyyyp
    qifgqkvpvgdpgrlrsmeqaleflntflegeqyvaggddptiadlsilatiatyevagy
    dlrryenvqrwyertsaivpgadknvegakvfgryf