PDB entry 3f61

View 3f61 on RCSB PDB site
Description: Crystal Structure of M. tuberculosis PknB Leu33Asp/Val222Asp double mutant in complex with ADP
Class: transferase
Keywords: protein kinase, PknB, Mycobacterium tuberculosis, Structural Genomics, PknB KD double mutant bound to ADP, TB Structural Genomics Consortium, TBSGC, ATP-binding, Kinase, Magnesium, Metal-binding, Nucleotide-binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase
Deposited on 2008-11-05, released 2008-12-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-01-13, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.205
AEROSPACI score: 0.48 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: serine/threonine-protein kinase pknb
    Species: Mycobacterium tuberculosis [TaxId:1773]
    Gene: MT0017, MTCY10H4.14c, pknB, Rv0014c
    Database cross-references and differences (RAF-indexed):
    • Uniprot P0A5S4 (3-End)
      • engineered (35)
      • engineered (224)
    Domains in SCOPe 2.04: d3f61a_
  • Heterogens: ADP, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f61A (A:)
    gshmttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfr
    reaqnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraie
    viadacqalnfshqngiihrdvkpanimisatnavkvmdfgiaraiadsgnsvtqtaavi
    gtaqylspeqargdsvdarsdvyslgcvlyevltgeppftgdspdsvayqhvredpipps
    arheglsadldavvlkalaknpenryqtaaemradlvrvhngeppeapkvltdaertsll
    ssaagnlsgpr
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f61A (A:)
    mttpshlsdryelgeilgfggmsevhlardlrdhrdvavkvlradlardpsfylrfrrea
    qnaaalnhpaivavydtgeaetpagplpyivmeyvdgvtlrdivhtegpmtpkraievia
    dacqalnfshqngiihrdvkpanimisatnavkvmdfgiaaqylspeqargdsvdarsdv
    yslgcvlyevltgeppftgdspdsvayqhvredpippsarheglsadldavvlkalaknp
    enryqtaaemradlvrvhngeppeapkvltd