PDB entry 3f5u

View 3f5u on RCSB PDB site
Description: Crystal structure of the death associated protein kinase in complex with AMPPNP and Mg2+
Class: transferase
Keywords: kinase-AMPPNP complex, Alternative splicing, ANK repeat, Apoptosis, ATP-binding, Calmodulin-binding, Cytoplasm, Kinase, Nucleotide-binding, Phosphoprotein, Polymorphism, Serine/threonine-protein kinase, Transferase
Deposited on 2008-11-04, released 2009-03-24
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-03-24, with a file datestamp of 2009-03-20.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.18
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene: DAPK, DAPK1, death-associated protein kinase 1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P53355
      • expression tag (290-293)
    Domains in SCOPe 2.04: d3f5ua_
  • Heterogens: ANP, MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f5uA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpkdtqqalssawshpqfek
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5uA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwikppqfe