PDB entry 3f5r

View 3f5r on RCSB PDB site
Description: The crystal structure of a subunit of the heterodimeric FACT complex (Spt16p-Pob3p).
Deposited on 2008-11-04, released 2008-11-18
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.181
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: FACT complex subunit POB3
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Gene: POB3, Saccharomyces cerevisiae, YML069W
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q04636 (21-End)
      • expression tag (19-20)
  • Heterogens: CL, FMT, GOL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3f5rA (A:)
mgsshhhhhhssgrenlyfqgmstdfdriylnqskfsgrfriadsglgwkistsggsaan
qarkpfllpatelstvqwsrgcrgydlkintknqgviqldgfsqddynlikndfhrrfni
qveqrehslrgwnwgktdlarnemvfalngkptfeipyarinntnltsknevgiefniqd
eeyqpagdegs

    Sequence, based on observed residues (ATOM records):
    >3f5rA (A:)
qgmstdfdriylnqskfsgrfriadsglgwkistsggsaanqarkpfllpatelstvqws
rgcrgydlkintknqgviqldgfsqddynlikndfhrrfniqveqrehslrgw