PDB entry 3f5q

View 3f5q on RCSB PDB site
Description: CRYSTAL STRUCTURE OF putative short chain dehydrogenase from Escherichia coli CFT073
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, CRYSTAL STRUCTURE,PROTEIN STRUCTURE INITIATIVE, NEW YORK STRUCTURAL GENOMIX RESEARCH CONSORTIUM, NYSGXRC, dehydrogenase, Oxidoreductase, PSI-2, New York SGX Research Center for Structural Genomics
Deposited on 2008-11-04, released 2009-01-13
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.76 Å
R-factor: 0.173
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dehydrogenase
    Species: Escherichia coli O6 [TaxId:217992]
    Gene: AAN80202.1, c1736, yciK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f5qa_
  • Chain 'B':
    Compound: dehydrogenase
    Species: Escherichia coli O6 [TaxId:217992]
    Gene: AAN80202.1, c1736, yciK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f5qb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f5qA (A:)
    mslhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashine
    etgrqpqwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwq
    dvmqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqv
    ladeyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgm
    tfdaqpgrkpgisqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5qA (A:)
    qpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrq
    pqwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwqdvmqv
    nvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladey
    qqrlrvncinpggtrqklktpadimplylwlmgddsrrktgmtfdaqp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f5qB (B:)
    mslhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashine
    etgrqpqwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwq
    dvmqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqv
    ladeyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgm
    tfdaqpgrkpgisqeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5qB (B:)
    qpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineetgrq
    pqwfildlltctsedcqqlaqriavnyprldgvlhnagllgdvcpmseqdpqvwqdvmqv
    nvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvladey
    qqrlrvncinpggtrdpqklktpadimplylwlmgddsrrktgmtfdaq