PDB entry 3f5o

View 3f5o on RCSB PDB site
Description: Crystal Structure of hTHEM2(undecan-2-one-CoA) complex
Class: Hydrolase
Keywords: hotdog fold, Hydrolase
Deposited on 2008-11-04, released 2009-08-18
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-18, with a file datestamp of 2009-08-14.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.201
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5oa_
  • Chain 'B':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5ob_
  • Chain 'C':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5oc_
  • Chain 'D':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5od_
  • Chain 'E':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5oe_
  • Chain 'F':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5of_
  • Chain 'G':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5og_
  • Chain 'H':
    Compound: Thioesterase superfamily member 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d3f5oh_
  • Heterogens: CL, UOC, COA, P6G, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f5oA (A:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oA (A:)
    tsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglta
    tlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdlt
    nkatgkliaqgrhtkhlg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f5oB (B:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oB (B:)
    mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
    vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
    atgkliaqgrhtkhlg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f5oC (C:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oC (C:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhlg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f5oD (D:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oD (D:)
    smtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltat
    lvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltn
    katgkliaqgrhtkhlg
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3f5oE (E:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oE (E:)
    tsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglta
    tlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdlt
    nkatgkliaqgrhtkhlg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3f5oF (F:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oF (F:)
    tsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglta
    tlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdlt
    nkatgkliaqgrhtkhlg
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3f5oG (G:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oG (G:)
    mtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhggltatl
    vdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdltnk
    atgkliaqgrhtkhlg
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3f5oH (H:)
    mtsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglt
    atlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdl
    tnkatgkliaqgrhtkhlgnlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5oH (H:)
    tsmtqslrevikamtkarnfervlgkitlvsaapgkvicemkveeehtnaigtlhgglta
    tlvdnistmallctergapgvsvdmnitymspaklgedivitahvlkqgktlaftsvdlt
    nkatgkliaqgrhtkhlg