PDB entry 3f5l

View 3f5l on RCSB PDB site
Description: Semi-active E176Q mutant of rice BGlu1, a plant exoglucanase/beta-glucosidase
Class: hydrolase
Keywords: beta-alpha-barrels, Glycosidase, Hydrolase
Deposited on 2008-11-04, released 2009-11-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-12-22, with a file datestamp of 2010-12-17.
Experiment type: XRAY
Resolution: 1.37 Å
R-factor: 0.182
AEROSPACI score: 0.69 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-glucosidase
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: Os3bglu7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42975 (Start-480)
      • engineered mutation (180)
    Domains in SCOPe 2.07: d3f5la_
  • Chain 'B':
    Compound: Beta-glucosidase
    Species: Oryza sativa Japonica Group [TaxId:39947]
    Gene: Os3bglu7
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q42975 (Start-480)
      • engineered mutation (180)
    Domains in SCOPe 2.07: d3f5lb_
  • Heterogens: LB2, ZN, SO4, MES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f5lA (A:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    qprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5lA (A:)
    nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
    dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
    yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
    ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
    nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
    gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
    gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
    anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f5lB (B:)
    amadvvpkpnwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnva
    gnqngdvatdqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlin
    yllqkgitpyvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfn
    qprivallgydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqq
    gkvgivldfnwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkf
    tpeqarlvkgsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqan
    snwlyivpwgmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsylt
    qlkkaideganvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlk
    h
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f5lB (B:)
    nwlgglsraafpkrfvfgtvtsayqvegmaasggrgpsiwdafahtpgnvagnqngdvat
    dqyhrykedvnlmkslnfdayrfsiswsrifpdgegrvnqegvayynnlinyllqkgitp
    yvnlyhydlplalekkyggwlnakmadlfteyadfcfktfgnrvkhwftfnqprivallg
    ydqgtnppkrctkcaaggnsatepyivahnfllshaaavaryrtkyqaaqqgkvgivldf
    nwyealsnstedqaaaqrardfhigwyldplinghypqimqdlvkdrlpkftpeqarlvk
    gsadyiginqytasymkgqqlmqqtptsysadwqvtyvfakngkpigpqansnwlyivpw
    gmygcvnyikqkygnptvvitengmdqpanlsrdqylrdttrvhfyrsyltqlkkaideg
    anvagyfawslldnfewlsgytskfgivyvdfntlerhpkasaywfrdmlkh