SCOPe 2.08: Structural Classification of Proteins

PDB entry 3f4n

View 3f4n on RCSB PDB site
Description: Crystal Structure of Pyridoxal Phosphate Biosynthetic Protein PdxJ from Yersinia pestis
Class: biosynthetic protein, transferase
Keywords: TIM barrel, Octamer, Pyridoxine biosynthesis, Transferase, CSGID, BIOSYNTHETIC PROTEIN, Structural Genomics, Structural Genomics of National Institute of Allergy and Infectious Diseases, Center for Structural Genomics of Infectious Diseases, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2008-11-01, released 2008-11-25
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.195
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

Chain 'A':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4na_
Chain 'B':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4nb_
Chain 'C':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (3-245)
  - expression tag (2)
Domains in SCOPe 2.08: d3f4nc1, d3f4nc2
Chain 'D':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4nd_
Chain 'E':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4ne_
Chain 'F':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4nf_
Chain 'G':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4ng_
Chain 'H':
Compound: pyridoxine 5'-phosphate synthase
Species: Yersinia pestis [TaxId:632]
Gene: pdxJ, y1300, YPO2930, YP_2525
Database cross-references and differences (RAF-indexed):
- Uniprot Q8ZCP4 (Start-245)
Domains in SCOPe 2.08: d3f4nh_
Heterogens: PXP, SO4, HOH

PDB Chain Sequences:

Chain 'A':
Sequence, based on SEQRES records: (download)

>3f4nA (A:)
snamadlllgvnidhiatlrnargtiypdpvqaafiaeqagadgitvhlredrrhitdrd
vrilrqtiqtrmnlemavtdemvdiacdikphfcclvpekrqevtteggldvagqvdkmt
lavgrladvgilvslfidadfrqidaavaagapyieihtgayadastvlerqaelmriak
aatyaagkglkvnaghgltyhnvqpiaalpemhelnighaiigqavmtglaaavtdmkvl
mrearr