PDB entry 3f4b

View 3f4b on RCSB PDB site
Description: Crystal structure of Plasmodium berghei Enoyl-acyl-carrier-protein reductase with TRICLOSAN
Class: oxidoreductase
Keywords: PbENR, PbFabI, triclosan, OXIDOREDUCTASE
Deposited on 2008-10-31, released 2010-03-02
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-06-19, with a file datestamp of 2013-06-14.
Experiment type: XRAY
Resolution: 2.49 Å
R-factor: 0.183
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: enoyl-acyl carrier protein reductase
    Species: Plasmodium berghei [TaxId:5821]
    Gene: pbfabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f4ba_
  • Chain 'B':
    Compound: enoyl-acyl carrier protein reductase
    Species: Plasmodium berghei [TaxId:5821]
    Gene: pbfabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f4bb_
  • Chain 'C':
    Compound: enoyl-acyl carrier protein reductase
    Species: Plasmodium berghei [TaxId:5821]
    Gene: pbfabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f4bc_
  • Chain 'D':
    Compound: enoyl-acyl carrier protein reductase
    Species: Plasmodium berghei [TaxId:5821]
    Gene: pbfabI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.03: d3f4bd_
  • Heterogens: NAD, TCL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f4bA (A:)
    mkneneneicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkd
    miinndnskrmqildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygk
    ismlvhslangrevqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyq
    asqkvvpgygggmssakaalesdtrvlayylgrkynirintisagplksraatainkfnn
    nqknnmnssgetdkqnysfidyaidysekyaplkkkllstdvgsvasfllskessavtgq
    tiyvdnglnimfgpddlfqssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f4bA (A:)
    neicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkdmiikrm
    qildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygkismlvhslang
    revqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyqasqkvvpgygg
    gmssakaalesdtrvlayylgrkynirintisagplksraatainsfidyaidysekyap
    lkkkllstdvgsvasfllskessavtgqtiyvdnglnimfgpdd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f4bB (B:)
    mkneneneicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkd
    miinndnskrmqildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygk
    ismlvhslangrevqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyq
    asqkvvpgygggmssakaalesdtrvlayylgrkynirintisagplksraatainkfnn
    nqknnmnssgetdkqnysfidyaidysekyaplkkkllstdvgsvasfllskessavtgq
    tiyvdnglnimfgpddlfqssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f4bB (B:)
    neicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkdmiinnd
    nskrmqildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygkismlvh
    slangrevqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyqasqkvv
    pgygggmssakaalesdtrvlayylgrkynirintisagplksraataiysfidyaidys
    ekyaplkkkllstdvgsvasfllskessavtgqtiyvdnglnimfgpdd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f4bC (C:)
    mkneneneicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkd
    miinndnskrmqildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygk
    ismlvhslangrevqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyq
    asqkvvpgygggmssakaalesdtrvlayylgrkynirintisagplksraatainkfnn
    nqknnmnssgetdkqnysfidyaidysekyaplkkkllstdvgsvasfllskessavtgq
    tiyvdnglnimfgpddlfqssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f4bC (C:)
    neicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkdmiirmq
    ildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygkismlvhslangr
    evqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyqasqkvvpgyggg
    mssakaalesdtrvlayylgrkynirintisagplksraataisfidyaidysekyaplk
    kkllstdvgsvasfllskessavtgqtiyvdnglnimfgpdd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f4bD (D:)
    mkneneneicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkd
    miinndnskrmqildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygk
    ismlvhslangrevqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyq
    asqkvvpgygggmssakaalesdtrvlayylgrkynirintisagplksraatainkfnn
    nqknnmnssgetdkqnysfidyaidysekyaplkkkllstdvgsvasfllskessavtgq
    tiyvdnglnimfgpddlfqssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f4bD (D:)
    neicfiagvgdsngygwgiakelskrnvkvifgvwppvynifiknlesgkfdkdmiinnd
    nskrmqildvlpldagfdnyddidedtknnkrynnlknysieevanliynkygkismlvh
    slangrevqkslldtsrdgyldaiskssyslislckhfckfmnsggsvvsltyqasqkvv
    pgygggmssakaalesdtrvlayylgrkynirintisagplksraataiysfidyaidys
    ekyaplkkkllstdvgsvasfllskessavtgqtiyvdnglnimfgpdd