PDB entry 3f47

View 3f47 on RCSB PDB site
Description: The Crystal Structure of [Fe]-Hydrogenase (Hmd) Holoenzyme from Methanocaldococcus jannaschii
Class: oxidoreductase
Keywords: ROSSMANN FOLD, HELIX BUNDLE, COMPLEX WITH IRON GUANYLYL PYRIDINOL COFACTOR, Methanogenesis, One-carbon metabolism, Oxidoreductase
Deposited on 2008-10-31, released 2009-02-10
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.174
AEROSPACI score: 0.55 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 5,10-methenyltetrahydromethanopterin hydrogenase
    Species: Methanocaldococcus jannaschii [TaxId:2190]
    Gene: hmd, MJ0784
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f47a1, d3f47a2
  • Heterogens: I2C, FE2, CMO, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f47A (A:)
    mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
    ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
    lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
    tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
    mpanligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkek
    gianmeealdpaallgtadsmcfgplaeilptalkvlekhkvveeegktkceimsqke
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f47A (A:)
    mkiailgagcyrthaaagitnfmracevakevgkpeialthssitygaellhlvpdvkev
    ivsdpcfaeepglvvidefdpkevmeahlsgnpesimpkirevvkakakelpkppkacih
    lvhpedvglkvtsddreavegadivitwlpkgnkqpdiikkfadaipegaivthactipt
    tkfakifkdlgredlnitsyhpgcvpemkgqvyiaegyaseeavnklyeigkiargkafk
    mpanligpvcdmcsavtatvyagllayrdavtkilgapadfaqmmadealtqihnlmkek
    gianmeealdpaallgtadsmcfgplaeilptalkvlekhkvve