PDB entry 3f45

View 3f45 on RCSB PDB site
Description: Structure of the R75A mutant of rat alpha-Parvalbumin
Class: calcium binding protein
Keywords: calcium binding protein, EF-hand, Acetylation, Calcium, Muscle protein, Phosphoprotein
Deposited on 2008-10-31, released 2009-07-07
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-08-04, with a file datestamp of 2009-07-31.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.147
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: parvalbumin alpha
    Species: Rattus norvegicus [TaxId:10116]
    Gene: PVALB, PVA
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02625 (0-108)
      • engineered (74)
    Domains in SCOPe 2.01: d3f45a_
  • Heterogens: CA, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f45A (A:)
    smtdllsaedikkaigaftaadsfdhkkffqmvglkkksaddvkkvfhildkdksgfiee
    delgsilkgfssdaadlsaketktlmaagdkdgdgkigveefstlvaes