PDB entry 3f40

View 3f40 on RCSB PDB site
Description: crystal structure of ntf2-like protein of unknown function (yp_677363.1) from cytophaga hutchinsonii atcc 33406 at 1.27 a resolution
Deposited on 2008-10-31, released 2008-11-18
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 1.27 Å
R-factor: N/A
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: uncharacterized NTF2-like protein
    Species: Cytophaga hutchinsonii ATCC 33406 [TaxId:269798]
    Gene: CHU_0736, YP_677363.1
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3f40A (A:)
gmktqittrdlvlefihalntenfpaakkrlnenftfngpmghregserymndmekmkfk
yvvhkmfeegndvcliydinmngktiaasglyhlekgeitslhvyfdprplfee

    Sequence, based on observed residues (ATOM records):
    >3f40A (A:)
mktqittrdlvlefihalntenfpaakkrlnenftfngpmghregserymndmekmkfky
vvhkmfeegndvcliydinmngktiaasglyhlekgeitslhvyfdprplfe