PDB entry 3f3y

View 3f3y on RCSB PDB site
Description: Crystal structure of human cytosolic sulfotransferase SULT2A1 in complex with PAP and lithocholic acid
Class: transferase
Keywords: SULT2A1, human cytosolic sulfotransferase, lithocholic acid, PAP, Bile acid catabolism, Cytoplasm, Lipid metabolism, Steroid metabolism, Transferase
Deposited on 2008-10-31, released 2009-09-15
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-09-15, with a file datestamp of 2009-09-11.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.238
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bile salt sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HST, STD, SULT2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f3ya_
  • Chain 'B':
    Compound: Bile salt sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HST, STD, SULT2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f3yb_
  • Chain 'C':
    Compound: Bile salt sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HST, STD, SULT2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f3yc_
  • Chain 'D':
    Compound: Bile salt sulfotransferase
    Species: Homo sapiens [TaxId:9606]
    Gene: HST, STD, SULT2A1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d3f3yd_
  • Heterogens: 4OA, A3P, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f3yA (A:)
    msddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhsk
    gdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylm
    rnprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfl
    llsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvv
    dkaqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f3yA (A:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
    qllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f3yB (B:)
    msddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhsk
    gdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylm
    rnprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfl
    llsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvv
    dkaqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f3yB (B:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
    qllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3f3yC (C:)
    msddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhsk
    gdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylm
    rnprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfl
    llsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvv
    dkaqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f3yC (C:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
    qllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3f3yD (D:)
    msddflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhsk
    gdakwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylm
    rnprdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfl
    llsyeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvv
    dkaqllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f3yD (D:)
    dflwfegiafptmgfrsetlrkvrdefvirdedviiltypksgtnwlaeilclmhskgda
    kwiqsvpiwerspwveseigytalsetesprlfsshlpiqlfpksffsskakviylmrnp
    rdvlvsgyffwknmkfikkpksweeyfewfcqgtvlygswfdhihgwmpmreeknfllls
    yeelkqdtgrtiekicqflgktlepeelnlilknssfqsmkenkmsnysllsvdyvvdka
    qllrkgvsgdwknhftvaqaedfdklfqekmadlprelfpwe