PDB entry 3f3b

View 3f3b on RCSB PDB site
Description: structure of the phage-like element pbsx protein xkdh from bacillus subtilus. northeast structural genomics consortium target sr352.
Deposited on 2008-10-30, released 2008-11-25
The last revision was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Phage-like element PBSX protein xkdH
    Species: Bacillus subtilis [TaxId:1423]
    Gene: xkdH, BSU12620
    Database cross-references and differences (RAF-indexed):
  • Heterogens: PO4, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3f3bA (A:)
msyrqmlihrcdiyheaaqapsagrfgipadrlqpvisypdtpdeqdvpcyftektqqli
qeepdqtvyhsflvhfplsadirvndkiiwenhkyilklpkrirhhhwevvavrdeslle
hhhhhh

    Sequence, based on observed residues (ATOM records):
    >3f3bA (A:)
rqmlihrcdiyheaaqapsagrfgipadrlqpvisypdtpdeqdvpcyftektqqliqee
pdqtvyhsflvhfplsadirvndkiiwenhkyilklpkrirhhhwevvavrdesl