PDB entry 3f2u

View 3f2u on RCSB PDB site
Description: Crystal structure of human chromobox homolog 1 (CBX1)
Class: protein binding
Keywords: Human chromobox homolog 1, CBX1, Structural Genomics, Structural Genomics Consortium, SGC, Centromere, Nucleus, Phosphoprotein, PROTEIN BINDING
Deposited on 2008-10-30, released 2008-11-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.224
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chromobox protein homolog 1
    Species: Homo sapiens [TaxId:9606]
    Gene: CBX1, CBX
    Database cross-references and differences (RAF-indexed):
    • Uniprot P83916 (1-End)
      • expression tag (0)
    Domains in SCOPe 2.05: d3f2ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f2uA (A:)
    geyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaeflqsqkt
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f2uA (A:)
    geyvvekvldrrvvkgkveyllkwkgfsdedntwepeenldcpdliaeflq