PDB entry 3f2l

View 3f2l on RCSB PDB site
Description: Crystal structure analysis of the K171A mutation of N-terminal type II cohesin 1 from the cellulosomal ScaB subunit of Acetivibrio cellulolyticus
Class: structural protein
Keywords: Point mutation, STRUCTURAL PROTEIN
Deposited on 2008-10-30, released 2008-12-02
The last revision prior to the SCOPe 2.01 freeze date was dated 2008-12-02, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.142
AEROSPACI score: 0.54 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cellulosomal scaffoldin adaptor protein B
    Species: Acetivibrio cellulolyticus [TaxId:35830]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q7WYN3 (1-End)
      • engineered (170)
    Domains in SCOPe 2.01: d3f2la_
  • Heterogens: EDO, NH4, NO3, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3f2lA (A:)
maptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytk
stmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkv
lkeetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmiaasle

    Sequence, based on observed residues (ATOM records): (download) 
    >3f2lA (A:)
aptssieivldkttasvgeivtasiniknitnfsgcqlnmkydpavlqpvtssgvaytks
tmpgagtilnsdfnlrqvadndlekgilnfskayvslddyrtaaapeqtgtvavvkfkvl
keetssisfedttsvpnaidgtvlfdwngdriqsgysviqpavinldmiaa