PDB entry 3f2e

View 3f2e on RCSB PDB site
Description: crystal structure of yellowstone sirv coat protein c-terminus
Deposited on 2008-10-29, released 2009-04-21
The last revision was dated 2020-02-26, with a file datestamp of 2020-02-21.
Experiment type: XRAY
Resolution: 1.67 Å
R-factor: N/A
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SIRV coat protein
    Species: Sulfolobus islandicus rudivirus 1 variant YNP [TaxId:187213]
    Database cross-references and differences (RAF-indexed):
    • PDB 3F2E
  • Heterogens: CIT, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >3f2eA (A:)
mqtnvpkftavaeqvsavlsqygitgpnraiyqgfglkvaralnrlgggpalvnminglk
ayyisafnanptvldavtdiitgsptgyvsggsghhhhhh

    Sequence, based on observed residues (ATOM records):
    >3f2eA (A:)
ftavaeqvsavlsqygitgpnraiyqgfglkvaralnrlgggpalvnminglkayyisaf
nanptvldavtdiitgsptgyvs