PDB entry 3f1s

View 3f1s on RCSB PDB site
Description: Crystal structure of Protein Z complexed with protein Z-dependent inhibitor
Class: hydrolase inhibitor/hydrolase
Keywords: PZ, ZPI, complex, serpin, protease inhibitor, protease, Glycoprotein, Secreted, Serine protease inhibitor, Blood coagulation, Cleavage on pair of basic residues, EGF-like domain, Gamma-carboxyglutamic acid, Hydroxylation, Serine protease homolog, HYDROLASE INHIBITOR-HYDROLASE COMPLEX
Deposited on 2008-10-28, released 2009-06-30
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Protein Z-dependent protease inhibitor
    Species: Homo sapiens [TaxId:9606]
    Gene: SERPINA10, UNQ707/PRO1358, ZPI
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d3f1sa_
  • Chain 'B':
    Compound: Vitamin K-dependent protein Z
    Species: Homo sapiens [TaxId:9606]
    Gene: PROZ, PZ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P22891 (Start-275)
      • expression tag (276)
  • Heterogens: CL, EDO, FLC, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f1sA (A:)
    aseeekawlmasrqqlaketsnfgfsllrkismrhdgnmvfspfgmslamtglmlgatgp
    tetqikrglhlqalkptkpgllpslfkglretlsrnlelgltqgsfafihkdfdvketff
    nlskryfdtecvpmnfrnasqakrlmnhyinketrgkipklfdeinpetklilvdyilfk
    gkwltpfdpvftevdtfhldkyktikvpmmygagkfastfdknfrchvlklpyqgnatml
    vvlmekmgdhlaledylttdlvetwlrnmktrnmevffpkfkldqkyemhellrqmgirr
    ifspfadlselsatgrnlqvsrvlqrtvievdergteavagilseitaysmppvikvdrp
    fhfmiyeetsgmllflgrvvnptll
    

  • Chain 'B':
    No sequence available.