PDB entry 3f1p

View 3f1p on RCSB PDB site
Description: Crystal structure of a high affinity heterodimer of HIF2 alpha and ARNT C-terminal PAS domains
Class: transcription
Keywords: PAS domain, heterodimer, internal cavity, Activator, Angiogenesis, Congenital erythrocytosis, Developmental protein, Differentiation, Disease mutation, DNA-binding, Hydroxylation, Nucleus, Phosphoprotein, Transcription, Transcription regulation, Ubl conjugation, Alternative splicing, Polymorphism
Deposited on 2008-10-28, released 2009-01-20
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-25, with a file datestamp of 2017-10-20.
Experiment type: XRAY
Resolution: 1.17 Å
R-factor: N/A
AEROSPACI score: 0.67 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Endothelial PAS domain-containing protein 1
    Species: Homo sapiens [TaxId:9606]
    Gene: EPAS1, HIF2A, Hypoxia Inducible Factor 2 alpha, MOP2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q99814 (5-End)
      • expression tag (2-4)
      • engineered (13)
    Domains in SCOPe 2.08: d3f1pa1, d3f1pa2
  • Chain 'B':
    Compound: Aryl hydrocarbon receptor nuclear translocator
    Species: Homo sapiens [TaxId:9606]
    Gene: ARNT, Aryl Hydrocarbon Receptor Nuclear Translocator
    Database cross-references and differences (RAF-indexed):
    • Uniprot P27540
      • engineered (12)
    Domains in SCOPe 2.08: d3f1pb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >3f1pA (A:)
gefkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtksh
qnlctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiekn

    Sequence, based on observed residues (ATOM records): (download) 
    >3f1pA (A:)
fkgldsktflsehsmdmkftycddriteligyhpeellgrsayefyhaldsenmtkshqn
lctkgqvvsgqyrmlakhggyvwletqgtviynprnlqpqcimcvnyvlseiek

  • Chain 'B':
    Sequence, based on SEQRES records: (download) 
    >3f1pB (B:)
gefkglnvcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllr
dsfqqvvklkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvknssq
e

    Sequence, based on observed residues (ATOM records): (download) 
    >3f1pB (B:)
vcqptrfisrhniegiftfvdhrcvatvgyqpqellgknivefchpedqqllrdsfqqvv
klkgqvlsvmfrfrsknqewlwmrtssftfqnpysdeieyiictntnvkns