PDB entry 3f1l

View 3f1l on RCSB PDB site
Description: The 0.95 A structure of an oxidoreductase, yciK from E.coli
Class: oxidoreductase
Keywords: oxidoreductase, yciK, E. coli, NADP+, crystal structure
Deposited on 2008-10-28, released 2008-11-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 0.95 Å
R-factor: 0.171
AEROSPACI score: 1.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized oxidoreductase yciK
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: b1271, JW1263, yciK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f1la_
  • Chain 'B':
    Compound: Uncharacterized oxidoreductase yciK
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: b1271, JW1263, yciK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f1lb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3f1lA (A:)
    mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
    grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
    mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
    deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
    daqpgrkpgisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f1lA (A:)
    mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
    grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
    mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
    deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
    daqpg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3f1lB (B:)
    mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
    grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
    mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
    deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
    daqpgrkpgisq
    

    Sequence, based on observed residues (ATOM records): (download)
    >3f1lB (B:)
    mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
    grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
    mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
    deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
    daqp