PDB entry 3f1k

View 3f1k on RCSB PDB site
Description: Crystal Structure of yciK from E. coli, an oxidoreductase, complexed with NADP+ at 2.6A resolution
Class: oxidoreductase
Keywords: oxidoreductase, yciK, E. coli, NADP+, crystal structure
Deposited on 2008-10-28, released 2008-11-18
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.216
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Uncharacterized oxidoreductase yciK
    Species: Escherichia coli K12 [TaxId:83333]
    Gene: b1271, JW1263, yciK
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d3f1ka_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3f1kA (A:)
    mhyqpkqdllndriilvtgasdgigreaamtyarygatvillgrneeklrqvashineet
    grqpqwfildlltctsencqqlaqriavnyprldgvlhnagllgdvcpmseqnpqvwqdv
    mqvnvnatfmltqallplllksdagslvftsssvgrqgranwgayaaskfategmmqvla
    deyqqrlrvncinpggtrtamrasafptedpqklktpadimplylwlmgddsrrktgmtf
    daqpgrkpgisq