PDB entry 3f1i

View 3f1i on RCSB PDB site
Description: Human ESCRT-0 Core Complex
Deposited on 2008-10-28, released 2009-03-24
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.239
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'C':
  Compound: Signal transducing adapter molecule 1
  Species: Homo sapiens [TaxId:9606]
  Gene: Signal transducing adaptor molecule (STAM), STAM, STAM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92783
• Chain 'H':
  Compound: hepatocyte growth factor-regulated tyrosine kinase substrate
  Species: Homo sapiens [TaxId:9606]
  Gene: Hepatocyte growth factor regulated tyrosine kinase substrate (HGS), HGS, HRS
  Database cross-references and differences (RAF-indexed):
  • Uniprot O14964 (0-97)
• Chain 'S':
  Compound: Signal transducing adapter molecule 1
  Species: Homo sapiens [TaxId:9606]
  Gene: Signal transducing adaptor molecule (STAM), STAM, STAM1
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q92783 (0-76)
• Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

• Chain 'C':
  Sequence, based on SEQRES records:
  

  >3f1iC (C:)
  fidedkmdqllqmlqstdpsddqpdlpellhleamchqmgplidekledidrkhselsel
  nvkvmealslytklmne
  

  
  Sequence, based on observed residues (ATOM records):
  

  >3f1iC (C:)
  qmgplidekledidrkhselseln
  

  
  
• Chain 'H':
  Sequence; same for both SEQRES and ATOM records:
  

  >3f1iH (H:)
  sheqflkalqnavttfvnrmksnhmrgrsitndsavlslfqsingmhpqllellnqlder
  rlyyeglqdklaqirdargalsalreehreklrraaee
  

  
  
• Chain 'S':
  Sequence; same for both SEQRES and ATOM records:
  

  >3f1iS (S:)
  fidedkmdqllqmlqstdpsddqpdlpellhleamchqmgplidekledidrkhselsel
  nvkvmealslytklmne